Structure of PDB 5gm6 Chain I

Receptor sequence
>5gm6I (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEQVR
SNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEK
SS
3D structure
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
ChainI
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I M1 L4 M1 L4
BS02 rna I G6 G8 S9 K10 Q25 G6 G8 S9 K10 Q25
BS03 rna I M74 S80 R83 H84 K88 M71 S77 R80 H81 K85
BS04 rna I Y3 K11 Y3 K11
BS05 rna I M76 R83 M73 R80
BS06 ZN I C68 C71 H84 H90 C65 C68 H81 H87
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)

[Back to BioLiP]