Structure of PDB 5c4j Chain I

Receptor sequence

>5c4jI (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITN
IGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFF
VCLSCSHIFTSDQK

3D structure

PDB

5c4j Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C75 C103 C106	C74 C102 C105

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001172	RNA-templated transcription
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006281	DNA repair
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:5c4j, PDBe:5c4j, PDBj:5c4j
PDBsum	5c4j
PubMed	26186291
UniProt	P27999\|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 (Gene Name=RPB9)