Structure of PDB 4wfb Chain I

Receptor sequence

>4wfbI (length=131) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGF
EGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESG
VVKNEKSGIKILGNGSLDKKLTVKAHKFSAS

3D structure

• PDB: 4wfb Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
• Chain: I
• Resolution: 3.43 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	L3 H4 L6 S12 R13 K14 R16 R18 V19 G20 R21 G22 A24 T30 S31 G32 R33 H35 K36 Q38 K39 A40 R47 P48 G49 F50 E51 Q54 L55 P56 L57 F58 R59 R60 L61 P62 N68 N70 E98 S116	L3 H4 L6 S12 R13 K14 R16 R18 V19 G20 R21 G22 A24 T30 S31 G32 R33 H35 K36 Q38 K39 A40 R47 P48 G49 F50 E51 Q54 L55 P56 L57 F58 R59 R60 L61 P62 N68 N70 E98 S116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wfb, PDBe:4wfb, PDBj:4wfb
• PDBsum: 4wfb
• PubMed: 26464510
• UniProt: P0A0F8|RL15_STAA8 Large ribosomal subunit protein uL15 (Gene Name=rplO)