Structure of PDB 4v8t Chain I

Receptor sequence

>4v8tI (length=213) Species: 559292 (Saccharomyces cerevisiae S288C)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYK
FPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLEN
NIREFPEYFAAQA

3D structure

• PDB: 4v8t Cryo-Em Structures of Arx1 and Maturation Factors Rei1 and Jjj1 Bound to the 60S Ribosomal Subunit
• Chain: I
• Resolution: 8.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R3 R4 A6 R7 C8 K13 K15 P16 Y22 R24 K39 S61 E63 A64 A67 R90 H92 F94 R98 N100 Q112 M115 R116 G117 W119 R154 Y157 K158 P160 D193 G194 F196 K198	R2 R3 A5 R6 C7 K12 K14 P15 Y21 R23 K38 S60 E62 A63 A66 R89 H91 F93 R97 N99 Q104 M107 R108 G109 W111 R146 Y149 K150 P152 D185 G186 F188 K190
BS02	rna	I	Y11 E56 L57 I131 K202 K203 G204 L206	Y10 E55 L56 I123 K194 K195 G196 L198

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8t, PDBe:4v8t, PDBj:4v8t
• PDBsum: 4v8t
• PubMed: 23142985
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)