Structure of PDB 4u67 Chain I

Receptor sequence

>4u67I (length=134) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

GSRKDRKRVGRGPGGTDKTAGRGHKGQKSRSGAGKGAFFEGGRSRLIARL
PKRGFNNVGTTYEVVKLSQLQDLEDTTFDRDTLEAYRLVRRKNRPVKLLA
SGEISRAVTVHVDAASAAAIKAVEAAGGRVVLPE

3D structure

• PDB: 4u67 The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
• Chain: I
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R13 K17 R18 G20 R21 G22 P23 T26 K28 T29 A30 R32 G33 H34 K35 G36 Q37 K38 S39 R40 S41 G42 G44 K45 F48 F49 E50 R55 L56 R59 P61 R63 G64 F65 N67 G69 V74 L98 R100 R101 L109 A110 S126	R3 K7 R8 G10 R11 G12 P13 T16 K18 T19 A20 R22 G23 H24 K25 G26 Q27 K28 S29 R30 S31 G32 G34 K35 F38 F39 E40 R45 L46 R49 P51 R53 G54 F55 N57 G59 V64 L88 R90 R91 L99 A100 S116

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u67, PDBe:4u67, PDBj:4u67
• PDBsum: 4u67
• PubMed: 28689968
• UniProt: Q9RSK9|RL15_DEIRA Large ribosomal subunit protein uL15 (Gene Name=rplO)