Structure of PDB 4q66 Chain I

Receptor sequence

>4q66I (length=86) Species: 559292 (Saccharomyces cerevisiae S288C)

LMVGLDGAKTTVLYKLKLGVITTIPTGGLDRIRSLWRHYYVIFVVDSNRE
VMQRMLVFANKQDAAEITEKLGLATCATSGEGLYEG

3D structure

• PDB: 4q66 Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
• Chain: I
• Resolution: 3.354 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): L71
• Catalytic site (residue number reindexed from 1): L29
• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	I	D26 G27 A28 K30 T31 T32 P47 T48 G70 N126 K127 D129 C159 A160 T161	D6 G7 A8 K9 T10 T11 P25 T26 G28 N60 K61 D63 C76 A77 T78

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0006886 intracellular protein transport
• GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
• GO:0006893 Golgi to plasma membrane transport
• GO:0010636 positive regulation of mitochondrial fusion
• GO:0015031 protein transport
• GO:0016192 vesicle-mediated transport
• GO:0016236 macroautophagy
• GO:0019217 regulation of fatty acid metabolic process
• GO:0048193 Golgi vesicle transport
• GO:0090141 positive regulation of mitochondrial fission
• GO:1903292 protein localization to Golgi membrane
• GO:1903358 regulation of Golgi organization

Cellular Component

• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0044232 organelle membrane contact site

External links

• PDB: RCSB:4q66, PDBe:4q66, PDBj:4q66
• PDBsum: 4q66
• PubMed: 25203211
• UniProt: P11076|ARF1_YEAST ADP-ribosylation factor 1 (Gene Name=ARF1)