Structure of PDB 4m7d Chain I

Receptor sequence
>4m7dI (length=88) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTKYPH
LGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
3D structure
PDB4m7d Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
ChainI
Resolution2.595 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I F35 N37 R63 S65 F35 N37 R60 S62
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4m7d, PDBe:4m7d, PDBj:4m7d
PDBsum4m7d
PubMed24240276
UniProtP38203|LSM2_YEAST U6 snRNA-associated Sm-like protein LSm2 (Gene Name=LSM2)

[Back to BioLiP]