Structure of PDB 4gkk Chain I

Receptor sequence

>4gkkI (length=127) Species: 300852 (Thermus thermophilus HB8)

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 4gkk Expanded use of sense codons is regulated by modified cytidines in tRNA.
• Chain: I
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	E2 Q3 Y5 T7 R9 R10 K11 E12 V14 R16 R20 Y36 Q38 Y62 R66 G67 G68 G69 K70 S71 Q73 R83 R93 K97 L102 T103 R104 A106 R107 V108 E110 R111 K112 K113 Y114 G115 H117 K118 R120 R121 Q124 Y125 S126 R128	E1 Q2 Y4 T6 R8 R9 K10 E11 V13 R15 R19 Y35 Q37 Y61 R65 G66 G67 G68 K69 S70 Q72 R82 R92 K96 L101 T102 R103 A105 R106 V107 E109 R110 K111 K112 Y113 G114 H116 K117 R119 R120 Q123 Y124 S125 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4gkk, PDBe:4gkk, PDBj:4gkk
• PDBsum: 4gkk
• PubMed: 23781103
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)