Structure of PDB 4ce4 Chain I |
>4ce4I (length=57) Species: 9825 (Sus scrofa domesticus) [Search protein sequence] |
LELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEE KLLRQEG |
|
PDB | 4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome. |
Chain | I |
Resolution | 4.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
I |
K116 N121 R122 |
K23 N28 R29 |
|
|
|
|