Structure of PDB 4c3i Chain I

Receptor sequence

>4c3iI (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTT
ADDAFPSSLRAKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQL
RSADEGATVFYTCTSCGYKFRTNN

3D structure

PDB

4c3i Crystal Structure of the 14-Subunit RNA Polymerase I

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C10 C30	C9 C29

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:4c3i, PDBe:4c3i, PDBj:4c3i
PDBsum	4c3i
PubMed	24153184
UniProt	P32529\|RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 (Gene Name=RPA12)