Structure of PDB 4by9 Chain I

Receptor sequence

>4by9I (length=366) Species: 2261 (Pyrococcus furiosus)

FISENVRGIYAFDENGNLIEKRYFTDKPEKVLDQLLKGEITKDLEELLNS
LKEKGYDEFVFEHPELSRRAKELGFSATTEFPNIAGERLRSNPEEFLGEN
WFEEYYKVGVALTRMRIQEQSGARDKMVIQAIEALDDVDKVINLLVARLR
EWYSLHFPELDELLPKHPQYVAFVKTVGHRDNINEEVLRELGLSEEKIKK
ILEAKEKTMGAWMDQTDIEVVRQLAEEIDRLYQLRKKLEDYIDRAMDDVA
PNLKALVGAKLAARLISLAGGLRELAMMPSSTIQVLGAEKALFRHLRTGA
KPPKHGVIYQYPAINRSPWWQRGKIARALAGKLAIAARVDYFSGEYIAEE
LKKELEARIREIKEKY

3D structure

• PDB: 4by9 The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
• Chain: I
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	S281 Q284 K290 F293 R294 L296 K301 P302 P303 K304 H305 Y309 R322 G323 K324 R327 G331 R358 E361 K365 Y366	S281 Q284 K290 F293 R294 L296 K301 P302 P303 K304 H305 Y309 R322 G323 K324 R327 G331 R358 E361 K365 Y366
BS02	rna	I	R316 S317 P318 W319 R322	R316 S317 P318 W319 R322
BS03	rna	I	L296 R297 G299	L296 R297 G299
BS04	rna	I	K363 E364	K363 E364

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0030515 snoRNA binding

Cellular Component

• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:4by9, PDBe:4by9, PDBj:4by9
• PDBsum: 4by9
• PubMed: 24121435
• UniProt: Q8U4M1