Structure of PDB 4b3m Chain I

Receptor sequence

>4b3mI (length=127) Species: 300852 (Thermus thermophilus HB8)

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 4b3m 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
• Chain: I
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Q2 Y4 R8 R9 K10 E11 V13 R15 F17 R19 Y35 Q37 Y61 R65 G66 G67 G68 K69 S70 G71 Q72 R82 R92 K96 T102 R103 R106 V107 V108 E109 R110 K111 K112 Y113 G114 H116 K117 R119 R120 A121 Q123 Y124 S125 R127	Q2 Y4 R8 R9 K10 E11 V13 R15 F17 R19 Y35 Q37 Y61 R65 G66 G67 G68 K69 S70 G71 Q72 R82 R92 K96 T102 R103 R106 V107 V108 E109 R110 K111 K112 Y113 G114 H116 K117 R119 R120 A121 Q123 Y124 S125 R127
BS02	MG	I	L39 V40 R41	L39 V40 R41

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4b3m, PDBe:4b3m, PDBj:4b3m
• PDBsum: 4b3m
• PubMed: 24473108
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)