Structure of PDB 4ak4 Chain I

Receptor sequence

>4ak4I (length=133) Species: 3490 (Artocarpus integer)

GKAFDDGVFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITG
FTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

• PDB: 4ak4 Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
• Chain: I
• Resolution: 1.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	V8 T72 V79 F104 L106 D125 Y126 F127 S128 M129 Y130 L131	V8 T72 V79 F104 L106 D125 Y126 F127 S128 M129 Y130 L131
BS02	peptide	I	S105 P107 E109 N110 L133	S105 P107 E109 N110 L133

Gene Ontology

Molecular Function

• GO:0019862 IgA binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4ak4, PDBe:4ak4, PDBj:4ak4
• PDBsum: 4ak4
• PubMed: 24915077
• UniProt: P18670|LECA_ARTIN Agglutinin alpha chain