Structure of PDB 3zk2 Chain I |
>3zk2I (length=89) Species: 851 (Fusobacterium nucleatum) [Search protein sequence] |
MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEAR GSIISTMILGQAVAESTGIYSLVIALILLYANPFLSKLG |
|
PDB | 3zk2 A new type of Na(+)-driven ATP synthase membrane rotor with a two-carboxylate ion-coupling motif. |
Chain | I |
Resolution | 2.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DMU |
I |
M1 D2 I9 |
M1 D2 I9 |
|
|
|
|