Structure of PDB 3qsi Chain I |
>3qsiI (length=79) Species: 210 (Helicobacter pylori) [Search protein sequence] |
KIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIIL QGNSFEIQRLQLEIGGLRGVKFAKLTKAS |
|
PDB | 3qsi Ni(II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect. |
Chain | I |
Resolution | 3.08 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
I |
H99 H101 C107 |
H36 H38 C44 |
|
|
|