Structure of PDB 3qrf Chain I |
>3qrfI (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] |
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAI RHNLSLHKCFVRVESEKGAVWTVDELEFRKKR |
|
PDB | 3qrf Structure of a Domain-Swapped FOXP3 Dimer on DNA and Its Function in Regulatory T Cells. |
Chain | I |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
I |
L389 S390 H392 F395 |
L54 S55 H57 F60 |
|
|
|
|