Structure of PDB 3kcg Chain I

Receptor sequence

>3kcgI (length=419) Species: 9606 (Homo sapiens)

SPVDICTAKPRDIPMNPMCIYRSPEQKIPEATNRRVWELSKANSRFATTF
YQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTIS
EKTSDQIHFFFAKLNCRLYRKANKASKLVSANRLFGDKSLTFNETYQDIS
ELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTV
LVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRR
VAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELE
EMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDL
YVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFI
REVPLNTIIFMGRVANPCV

3D structure

• PDB: 3kcg Molecular basis of factor IXa recognition by heparin-activated antithrombin revealed by a 1.7-A structure of the ternary complex.
• Chain: I
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Z9L	I	R13 R47 E113	R11 R35 E101
BS02	Z9K	I	R13 R47 K114	R11 R35 K102
BS03	GU6	I	K11 P12 R13 K114 F122	K9 P10 R11 K102 F110
BS04	GU1	I	N45 K125	N33 K113
BS05	Z9H	I	A43 T44 N45 K125 R129	A31 T32 N33 K113 R117

Gene Ontology

Molecular Function

• GO:0002020 protease binding
• GO:0004867 serine-type endopeptidase inhibitor activity
• GO:0005515 protein binding
• GO:0008201 heparin binding
• GO:0042802 identical protein binding

Biological Process

• GO:0007596 blood coagulation
• GO:0010466 negative regulation of peptidase activity
• GO:0030193 regulation of blood coagulation

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005788 endoplasmic reticulum lumen
• GO:0005886 plasma membrane
• GO:0062023 collagen-containing extracellular matrix
• GO:0070062 extracellular exosome
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3kcg, PDBe:3kcg, PDBj:3kcg
• PDBsum: 3kcg
• PubMed: 20080729
• UniProt: P01008|ANT3_HUMAN Antithrombin-III (Gene Name=SERPINC1)