Structure of PDB 3jcu Chain I

Receptor sequence
>3jcuI (length=35) Species: 3562 (Spinacia oleracea) [Search protein sequence]
MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGRE
3D structure
PDB3jcu Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
ChainI
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I V8 Y9 V11 V12 I13 F15 V8 Y9 V11 V12 I13 F15
BS02 CLA I F19 F23 F19 F23
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcu, PDBe:3jcu, PDBj:3jcu
PDBsum3jcu
PubMed27251276
UniProtP62103|PSBI_SPIOL Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]