Structure of PDB 3j81 Chain I

Receptor sequence

>3j81I (length=188) Species: 28985 (Kluyveromyces lactis)

GISRDSRHKRAATGAKRAQFRKKRKFELGRQAANTKIGTKRIHPVRTRGG
NQKFRALRIETGNFSWASEGVARKTRITGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWYESHYGQSLGKTSKNTERKWAARAAEAKIEHAVDSQFGA
GRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
• Chain: I
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G2 R5 K10 R11 T14 G15 A16 K17 R18 F21 R22 K23 K24 R25 K26 F27 E28 L29 G30 R31 Q32 A33 A34 K41 R42 I43 R47 T48 R49 G50 N52 K54 R56 L58 R59 N64 S66 V72 A73 R74 K75 S86 N87 K98 S137 K138 N139 S171 S172 R173 G175 Q176 S177 R179 Y183	G1 R4 K9 R10 T13 G14 A15 K16 R17 F20 R21 K22 K23 R24 K25 F26 E27 L28 G29 R30 Q31 A32 A33 K40 R41 I42 R46 T47 R48 G49 N51 K53 R55 L57 R58 N63 S65 V71 A72 R73 K74 S85 N86 K97 S124 K125 N126 S158 S159 R160 G162 Q163 S164 R166 Y170

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j81, PDBe:3j81, PDBj:3j81
• PDBsum: 3j81
• PubMed: 25417110
• UniProt: Q6CMG3