Structure of PDB 3j80 Chain I

Receptor sequence

>3j80I (length=188) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

GISRDSRHKRAATGAKRAQFRKKRKFELGRQAANTKIGTKRIHPVRTRGG
NQKFRALRIETGNFSWASEGVARKTRITGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWYESHYGQSLGKTSKNTERKWAARAAEAKIEHAVDSQFGA
GRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

PDB

3j80 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.

Chain

Resolution

3.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G2 R5 D6 K10 R11 T14 A16 K17 R22 K23 K24 R25 K26 F27 G30 R31 Q32 K41 R42 I43 R47 T48 R49 G50 N52 K54 R56 L58 R59 N64 V72 A73 K75 S86 N87 T97 K98 A99 K138 N139 T140 R142 K143 S171 S172 R173 Q176 R179 D181 Y183	G1 R4 D5 K9 R10 T13 A15 K16 R21 K22 K23 R24 K25 F26 G29 R30 Q31 K40 R41 I42 R46 T47 R48 G49 N51 K53 R55 L57 R58 N63 V71 A72 K74 S85 N86 T96 K97 A98 K125 N126 T127 R129 K130 S158 S159 R160 Q163 R166 D168 Y170

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j80, PDBe:3j80, PDBj:3j80
PDBsum	3j80
PubMed	25417110
UniProt	Q6CMG3

[Back to BioLiP]