Structure of PDB 3j7q Chain I

Receptor sequence

>3j7qI (length=213) Species: 9823 (Sus scrofa)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGH
MVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINK
MLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEA
LRRAKFKFPGRQKIHISKKWGFTKFNADEFENMVAKKCLIPDGCGVKYVP
NHGPLDKWRVLHS

3D structure

• PDB: 3j7q Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
• Chain: I
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R3 R4 A6 R7 K13 K15 P16 F22 D35 K39 K40 S61 E63 A64 A67 R90 H92 F94 R98 N100 L103 R110 Q112 M115 R116 A118 F119 Q133 F157 K158 P160 D193 C195 K198	R2 R3 A5 R6 K12 K14 P15 F21 D34 K38 K39 S60 E62 A63 A66 R89 H91 F93 R97 N99 L102 R109 Q111 M114 R115 A117 F118 Q132 F156 K157 P159 D192 C194 K197
BS02	rna	I	Y11 E56 Y57 Y199 N202 H203 G204 L206	Y10 E55 Y56 Y198 N201 H202 G203 L205

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0045182 translation regulator activity

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:1990403 embryonic brain development

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j7q, PDBe:3j7q, PDBj:3j7q
• PDBsum: 3j7q
• PubMed: 24930395
• UniProt: Q29195|RL10_PIG Large ribosomal subunit protein uL16 (Gene Name=RPL10)