Structure of PDB 3j6b Chain I

Receptor sequence
>3j6bI (length=125) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MIFLKSVIKVIDNSGAQLAECIKVIRKGSPKSPAMVGDRIVCVIQKAKPV
KKGDICHAIVVRSKQRNMCRKDGSTVAFGDTACVLINKNTGEPLGTRIMA
NDGCVDRTLKDKGYNKICSLASRVI
3D structure
PDB3j6b Structure of the yeast mitochondrial large ribosomal subunit.
ChainI
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I M1 F3 L4 K5 S6 V7 I22 K23 K27 G28 S29 P30 K31 S32 V43 I68 H70 K77 Q78 R79 N80 M1 F3 L4 K5 S6 V7 I22 K23 K27 G28 S29 P30 K31 S32 V43 I55 H57 K64 Q65 R66 N67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum3j6b
PubMed24675956
UniProtP35996|RM38_YEAST Large ribosomal subunit protein uL14m (Gene Name=MRPL38)

[Back to BioLiP]