Structure of PDB 3i56 Chain I

Receptor sequence
>3i56I (length=70) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYD
LTNAAKEVVGTCTSLGVTIE
3D structure
PDB3i56 Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
ChainI
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I P69 T70 G83 S84 E86 P87 E89 D110 L111 L112 Y114 K121 G125 T126 S129 L130 P4 T5 G18 S19 E21 P22 E24 D45 L46 L47 Y49 K56 G60 T61 S64 L65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3i56, PDBe:3i56, PDBj:3i56
PDBsum3i56
PubMed19738021
UniProtP14122|RL11_HALMA Large ribosomal subunit protein uL11 (Gene Name=rpl11)

[Back to BioLiP]