Structure of PDB 3he3 Chain I

Receptor sequence

>3he3I (length=364) Species: 1299 (Deinococcus radiodurans)

SKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAG
VLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINL
DTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFF
RGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMF
QNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRS
LEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEY
PRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQV
VAQALATFRRLQGQ

3D structure

• PDB: 3he3 Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: I
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R172 R176 R249 R279 E299 Y344 N346
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	I	F175 F176 Y179 T180 W184 R198 V199 Y209 N296 R305 Y335 Y370	F149 F150 Y153 T154 W158 R172 V173 Y183 N270 R279 Y309 Y344
BS02	FAD	I	V35 G36 G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 Y243 R364 N372 M373 V376	V9 G10 G12 A14 D33 R34 R35 G40 N41 P58 H59 I60 Y217 R338 N346 M347 V350

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3he3, PDBe:3he3, PDBj:3he3
• PDBsum: 3he3
• PubMed: 19836401
• UniProt: Q9RYF1