Structure of PDB 3g6e Chain I

Receptor sequence
>3g6eI (length=70) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYD
LTNAAKEVVGTCTSLGVTIE
3D structure
PDB3g6e U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
ChainI
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I P69 T70 T82 G83 S84 P87 D110 L111 L112 S113 Y114 N118 K121 E122 G125 T126 S129 P4 T5 T17 G18 S19 P22 D45 L46 L47 S48 Y49 N53 K56 E57 G60 T61 S64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g6e, PDBe:3g6e, PDBj:3g6e
PDBsum3g6e
PubMed19362093
UniProtP14122|RL11_HALMA Large ribosomal subunit protein uL11 (Gene Name=rpl11)

[Back to BioLiP]