Structure of PDB 3e3q Chain I |
>3e3qI (length=109) Species: 10090 (Mus musculus) [Search protein sequence] |
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYS GDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSDPPPLLTF GSGTKVIVL |
|
PDB | 3e3q Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation. |
Chain | I |
Resolution | 2.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
I |
P101 P102 |
P95 P96 |
|
|
|