Structure of PDB 3cii Chain I |
>3ciiI (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] |
CSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFM SSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPN GNALDESCEDKNRYICKQQLI |
|
PDB | 3cii Structural basis for NKG2A/CD94 recognition of HLA-E. |
Chain | I |
Resolution | 4.41 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
I |
Q112 N156 N160 |
Q54 N98 N102 |
|
|
|