Structure of PDB 3bpd Chain I |
>3bpdI (length=90) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] |
LKGLRRLVLDVLKPHEPKTIVFALKLSELENVDGVNIHLSEIDQATENIK ITILGNNLDYEQIKGVIEDMGGVIHSVDEVVAGKIIVESV |
|
PDB | 3bpd Crystal structure of an uncharacterized protein (O28723_ARCFU) from Archaeoglobus fulgidus. |
Chain | I |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
I |
D10 S76 |
D10 S76 |
|
BS02 |
MG |
I |
E41 D43 |
E41 D43 |
|
|
|
|