Structure of PDB 2zjp Chain I

Receptor sequence

>2zjpI (length=141) Species: 1299 (Deinococcus radiodurans)

HDLKPTPGSRKDRKRVGRGPGGTDKTAGRGHKGQKSRSGAGKGAFFEGGR
SRLIARLPKRGFNNVGTTYEVVKLSQLQDLEDTTFDRDTLEAYRLVRRKN
RPVKLLASGEISRAVTVHVDAASAAAIKAVEAAGGRVVLPE

3D structure

• PDB: 2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
• Chain: I
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	K7 P8 T9 R13 K17 R18 G20 R21 G22 P23 G24 T26 G31 R32 H34 K35 G36 Q37 K38 R40 S41 G44 K45 F48 F49 E50 R53 L56 R59 L60 P61 R63 G64 F65 N67 G69 V74 L98 R100 R101 K107 L109 A110 S126 A127	K4 P5 T6 R10 K14 R15 G17 R18 G19 P20 G21 T23 G28 R29 H31 K32 G33 Q34 K35 R37 S38 G41 K42 F45 F46 E47 R50 L53 R56 L57 P58 R60 G61 F62 N64 G66 V71 L95 R97 R98 K104 L106 A107 S123 A124

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
• PDBsum: 2zjp
• PubMed: 18406324
• UniProt: Q9RSK9|RL15_DEIRA Large ribosomal subunit protein uL15 (Gene Name=rplO)