Structure of PDB 2ykr Chain I

Receptor sequence

>2ykrI (length=127) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.

Chain

Resolution

9.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	N3 Q4 Y6 T8 R10 K12 S13 A15 R17 F19 Q31 R32 E35 Q36 Y37 R40 E41 T42 Y63 K67 G68 G69 G70 I71 S72 G73 Q74 H80 R84 E91 R94 R98 K99 V103 R105 D106 R108 Q109 V110 E111 R112 K113 K114 V115 R118 A120 R121 R122 R123 P124 Q125 F126 S127 K128 R129	N1 Q2 Y4 T6 R8 K10 S11 A13 R15 F17 Q29 R30 E33 Q34 Y35 R38 E39 T40 Y61 K65 G66 G67 G68 I69 S70 G71 Q72 H78 R82 E89 R92 R96 K97 V101 R103 D104 R106 Q107 V108 E109 R110 K111 K112 V113 R116 A118 R119 R120 R121 P122 Q123 F124 S125 K126 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum	2ykr
PubMed	21788480
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)