Structure of PDB 2wsf Chain I

Receptor sequence
>2wsfI (length=30) Species: 3888 (Pisum sativum) [Search protein sequence]
MINLPSLFVPLVGLLFPAVAMASLFLHVEK
3D structure
PDB2wsf Structure determination and improved model of plant photosystem I.
ChainI
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I M21 F25 M21 F25
BS02 CLA I M21 A22 M21 A22
BS03 CLA I G13 L14 G13 L14
BS04 CLA I F8 V12 F8 V12
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wsf, PDBe:2wsf, PDBj:2wsf
PDBsum2wsf
PubMed19923216
UniProtP17227|PSAI_PEA Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]