Structure of PDB 2uz6 Chain I

Receptor sequence

>2uz6I (length=205) Species: 6500 (Aplysia californica)

QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDL
VYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVL
SPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGF
EIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVV
KFRER

3D structure

• PDB: 2uz6 Achbp-Targeted Alpha-Conotoxin Correlates Distinct Binding Orientations with Nachr Subtype Selectivity
• Chain: I
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	Y53 R57 V106 M114 S165	Y53 R57 V106 M114 S165
BS02	peptide	I	Y91 K141 W145 V146 Y186 C189 Y193 D195	Y91 K141 W145 V146 Y186 C189 Y193 D195

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:2uz6, PDBe:2uz6, PDBj:2uz6
• PDBsum: 2uz6
• PubMed: 17660751
• UniProt: Q8WSF8