Structure of PDB 2qq4 Chain I |
>2qq4I (length=134) Species: 274 (Thermus thermophilus) [Search protein sequence] |
DELYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTI ADIRFQGQGCAISTASASLMTEAVKGKKVAEALELSRKFQAMVVEGAPPD PTLGDLLALQGVAKLPARVKCATLAWHALEEALR |
|
PDB | 2qq4 Crystal structure of Iron-sulfur cluster biosynthesis protein IscU (TTHA1736) from thermus thermophilus HB8 |
Chain | I |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C39 D41 C64 C125 |
C35 D37 C60 C121 |
|
|
|
|