Structure of PDB 2qa4 Chain I

Receptor sequence
>2qa4I (length=118) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
IEVLVPGGEANPGPPLGPELPVDVQAVVQEINDQTAEVPVTVKYDDDGSF
EIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDL
LSYDLTNAAKEVVGTCTS
3D structure
PDB2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
ChainI
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I P70 T71 T83 G84 S85 G86 P88 K108 L112 L113 K122 E123 G126 T127 S130 P58 T59 T71 G72 S73 G74 P76 K96 L100 L101 K110 E111 G114 T115 S118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
PDBsum2qa4
PubMed17599351
UniProtP14122|RL11_HALMA Large ribosomal subunit protein uL11 (Gene Name=rpl11)

[Back to BioLiP]