Structure of PDB 2pno Chain I

Receptor sequence

>2pnoI (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]

KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYR
AQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSA
QLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL

3D structure

PDB

2pno Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.5.1.-
4.4.1.20: leukotriene-C4 synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	I	V26 I27 R30 Y50 Q53	V25 I26 R29 Y49 Q52
BS02	GSH	I	R51 N55 E58 Y59 Y93 Y97 R104 L108	R50 N54 E57 Y58 Y92 Y96 R103 L107

Gene Ontology

	Molecular Function
GO:0004364	glutathione transferase activity
GO:0004464	leukotriene-C4 synthase activity
GO:0004602	glutathione peroxidase activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0008289	lipid binding
GO:0016740	transferase activity
GO:0016829	lyase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006629	lipid metabolic process
GO:0006691	leukotriene metabolic process
GO:0019370	leukotriene biosynthetic process
GO:0042759	long-chain fatty acid biosynthetic process
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005640	nuclear outer membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:2pno, PDBe:2pno, PDBj:2pno
PDBsum	2pno
PubMed	17632548
UniProt	Q16873\|LTC4S_HUMAN Leukotriene C4 synthase (Gene Name=LTC4S)