Structure of PDB 2jkt Chain I

Receptor sequence
>2jktI (length=142) Species: 10090 (Mus musculus) [Search protein sequence]
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFV
EFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCE
LDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
3D structure
PDB2jkt A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
ChainI
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide I N9 R10 Y62 A63 V88 N97 V98 C99 E100 N9 R10 Y62 A63 V88 N97 V98 C99 E100
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035615 clathrin adaptor activity
Biological Process
GO:0006886 intracellular protein transport
GO:0006897 endocytosis
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0048488 synaptic vesicle endocytosis
GO:0072583 clathrin-dependent endocytosis
GO:0098884 postsynaptic neurotransmitter receptor internalization
Cellular Component
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009898 cytoplasmic side of plasma membrane
GO:0030117 membrane coat
GO:0030122 AP-2 adaptor complex
GO:0045202 synapse
GO:0071944 cell periphery
GO:0098793 presynapse
GO:0098794 postsynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jkt, PDBe:2jkt, PDBj:2jkt
PDBsum2jkt
PubMed19140243
UniProtP62743|AP2S1_MOUSE AP-2 complex subunit sigma (Gene Name=Ap2s1)

[Back to BioLiP]