Structure of PDB 2j7a Chain I

Receptor sequence

>2j7aI (length=145) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough)

KLVLGGATLGVVALATVAFGMKYTDQRPFCTSCHIMNPVGVTHKLSGHAN
ISCNDCHAPHNLLAKLPFKAIAGARDVYMNTLGHPGDLILAGMETKEVVN
ANCKACHTMTNVEVASMEAKKYCTDCHRNVQHMRMKPISTREVAD

3D structure

• PDB: 2j7a X-Ray Structure of the Membrane-Bound Cytochrome C Quinol Dehydrogenase Nrfh Reveals Novel Haem Coordination.
• Chain: I
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	I	C43 C46 I48 M49 H70 D89 V90 M92 N93 A104 T108	C30 C33 I35 M36 H57 D76 V77 M79 N80 A91 T95
BS02	HEC	I	M49 V52 H56 H61 I64 C66 C69 H70 K109 Q144 H145	M36 V39 H43 H48 I51 C53 C56 H57 K96 Q131 H132
BS03	HEC	I	H61 I64 D68 C69 N115 C116 C119 H120 H140	H48 I51 D55 C56 N102 C103 C106 H107 H127
BS04	HEC	I	C116 H120 N124 S129 C136 C139 H140	C103 H107 N111 S116 C123 C126 H127
BS05	HEC	I	C119 H120 M122 T123	C106 H107 M109 T110

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration
• GO:0019333 denitrification pathway

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2j7a, PDBe:2j7a, PDBj:2j7a
• PDBsum: 2j7a
• PubMed: 17139260
• UniProt: Q72EF4|NRFH_NITV2 Cytochrome c nitrite reductase subunit NrfH (Gene Name=DVU_0624)