Structure of PDB 1yjw Chain I

Receptor sequence
>1yjwI (length=70) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYD
LTNAAKEVVGTCTSLGVTIE
3D structure
PDB1yjw Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
ChainI
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I P69 T70 T82 G83 S84 G85 E86 P87 E89 K107 D110 L111 L112 S113 Y114 K121 E122 G125 T126 S129 L130 P4 T5 T17 G18 S19 G20 E21 P22 E24 K42 D45 L46 L47 S48 Y49 K56 E57 G60 T61 S64 L65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yjw, PDBe:1yjw, PDBj:1yjw
PDBsum1yjw
PubMed15851032
UniProtP14122|RL11_HALMA Large ribosomal subunit protein uL11 (Gene Name=rpl11)

[Back to BioLiP]