Structure of PDB 1y1v Chain I

Receptor sequence
>1y1vI (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITN
IGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFF
VCLSCSHIFTSDQKNKRTQ
3D structure
PDB1y1v Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
ChainI
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN I C7 C29 C6 C28
BS02 ZN I C75 C78 C103 C106 C74 C77 C102 C105
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001172 RNA-templated transcription
GO:0001193 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006351 DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005730 nucleolus
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1y1v, PDBe:1y1v, PDBj:1y1v
PDBsum1y1v
PubMed15610738
UniProtP27999|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 (Gene Name=RPB9)

[Back to BioLiP]