Structure of PDB 1vqm Chain I

Receptor sequence
>1vqmI (length=70) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYD
LTNAAKEVVGTCTSLGVTIE
3D structure
PDB1vqm Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
ChainI
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna I P74 T75 T87 G88 P92 D115 L116 L117 S118 Y119 N123 K126 E127 T131 S134 L135 P4 T5 T17 G18 P22 D45 L46 L47 S48 Y49 N53 K56 E57 T61 S64 L65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1vqm, PDBe:1vqm, PDBj:1vqm
PDBsum1vqm
PubMed16285925
UniProtP14122|RL11_HALMA Large ribosomal subunit protein uL11 (Gene Name=rpl11)

[Back to BioLiP]