Structure of PDB 1u8r Chain I

Receptor sequence
>1u8rI (length=221) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGLVRLTELPA
GSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVI
PGHENVTLPHEMAHAVKVEKV
3D structure
PDB1u8r Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions.
ChainI
Resolution2.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna I T7 Q36 S37 P39 T40 R47 R50 T7 Q36 S37 P39 T40 R47 R50
BS02 dna I A28 R29 R60 A28 R29 R60
BS03 CO I H79 E83 H98 E172 Q175 H79 E83 H98 E163 Q166
BS04 CO I M10 C102 E105 H106 M10 C102 E105 H106
BS05 CO I H219 H223 H210 H214
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0016151 nickel cation binding
GO:0030145 manganese ion binding
GO:0046870 cadmium ion binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
GO:0050897 cobalt ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006979 response to oxidative stress
GO:0019540 catechol-containing siderophore biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1u8r, PDBe:1u8r, PDBj:1u8r
PDBsum1u8r
PubMed15351642
UniProtP9WMH1|IDER_MYCTU Iron-dependent repressor IdeR (Gene Name=ideR)

[Back to BioLiP]