Structure of PDB 1r1l Chain I

Receptor sequence

>1r1lI (length=416) Species: 9606 (Homo sapiens)

VDICTAKPRDIPMNPMCIYRSPEKKPEATNRRVWELSKANSRFATTFYQH
LADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKT
SDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELV
YGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVL
VNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAE
GTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMM
LVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVS
DAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREV
PLNTIIFMGRVANPCV

3D structure

• PDB: 1r1l Serpins and the design of peptides to block intermolecular beta-linkages
• Chain: I
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	V190 R197 I198 N217 T218 I219 Y220 F221 K222 G223 W225 F274 H369 K370 A371 F372 L373 E374 V375 N376 F422	V175 R182 I183 N202 T203 I204 Y205 F206 K207 G208 W210 F259 H354 K355 A356 F357 L358 E359 V360 N361 F407
BS02	peptide	I	F87 T90 V212 L213 V214 L215 Y363 V364 S365 D366	F72 T75 V197 L198 V199 L200 Y348 V349 S350 D351

Gene Ontology

Molecular Function

• GO:0002020 protease binding
• GO:0004867 serine-type endopeptidase inhibitor activity
• GO:0005515 protein binding
• GO:0008201 heparin binding
• GO:0042802 identical protein binding

Biological Process

• GO:0007596 blood coagulation
• GO:0010466 negative regulation of peptidase activity
• GO:0030193 regulation of blood coagulation

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005788 endoplasmic reticulum lumen
• GO:0005886 plasma membrane
• GO:0062023 collagen-containing extracellular matrix
• GO:0070062 extracellular exosome
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1r1l, PDBe:1r1l, PDBj:1r1l
• PDBsum: 1r1l
• UniProt: P01008|ANT3_HUMAN Antithrombin-III (Gene Name=SERPINC1)