Structure of PDB 1nwx Chain I

Receptor sequence

>1nwxI (length=132) Species: 1299 (Deinococcus radiodurans)

IMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDII
VASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINN
QGEPRGTRVFGPVARELRDRRFMKIVSLAPEV

3D structure

• PDB: 1nwx Structural basis for the antibiotic activity of ketolides and azalides.
• Chain: I
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G37 G40 K42	G36 G39 K41

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1nwx, PDBe:1nwx, PDBj:1nwx
• PDBsum: 1nwx
• PubMed: 12623020
• UniProt: Q9RXJ2|RL14_DEIRA Large ribosomal subunit protein uL14 (Gene Name=rplN)