Structure of PDB 1ngm Chain I

Receptor sequence

>1ngmI (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM

3D structure

PDB

1ngm Crystal structure of a transcription factor IIIB core interface ternary complex

Chain

Resolution

2.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	I	V71 T73 F116 K120 V122 Q158 N159 L189 F190 R196 V203 L205 T215	V11 T13 F56 K60 V62 Q98 N99 L129 F130 R136 V143 L145 T155
BS02	dna	I	Q68 N69 R98 F99 I103 R105 T112 L114 T124 F190 P191 F207 S209 K211 V213	Q8 N9 R38 F39 I43 R45 T52 L54 T64 F130 P131 F147 S149 K151 V153

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ngm, PDBe:1ngm, PDBj:1ngm
PDBsum	1ngm
PubMed	12660736
UniProt	P13393\|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]