Structure of PDB 1nb5 Chain I

Receptor sequence
>1nb5I (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAG
TNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
3D structure
PDB1nb5 Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
ChainI
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide I M6 I7 M1 I2
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004866 endopeptidase inhibitor activity
GO:0004869 cysteine-type endopeptidase inhibitor activity
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0010466 negative regulation of peptidase activity
GO:0018149 peptide cross-linking
GO:0030216 keratinocyte differentiation
GO:0045861 negative regulation of proteolysis
GO:0098609 cell-cell adhesion
Cellular Component
GO:0001533 cornified envelope
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1904090 peptidase inhibitor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nb5, PDBe:1nb5, PDBj:1nb5
PDBsum1nb5
PubMed12581647
UniProtP01040|CYTA_HUMAN Cystatin-A (Gene Name=CSTA)

[Back to BioLiP]