Structure of PDB 1m8v Chain I

Receptor sequence

>1m8vI (length=71) Species: 29292 (Pyrococcus abyssi)

ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE
VVKRYGKIVIRGDNVLAISPT

3D structure

• PDB: 1m8v Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
• Chain: I
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	D207 H210 Y234	D5 H8 Y32
BS02	U	I	H237 N239 R263 D265	H35 N37 R61 D63

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome

Cellular Component

• GO:0120114 Sm-like protein family complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1m8v, PDBe:1m8v, PDBj:1m8v
• PDBsum: 1m8v
• PubMed: 12409299
• UniProt: Q9V0Y8|RUXX_PYRAB Putative snRNP Sm-like protein (Gene Name=PYRAB06500)