Structure of PDB 1i96 Chain I |
>1i96I (length=127) Species: 274 (Thermus thermophilus) [Search protein sequence] |
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR AVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF LTRDARVVERKKYGKHKARRAPQYSKR |
|
PDB | 1i96 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. |
Chain | I |
Resolution | 4.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
I |
G67 G68 G69 K113 |
G66 G67 G68 K112 |
|
|
|
|