Structure of PDB 1br8 Chain I

Receptor sequence

>1br8I (length=404) Species: 9606 (Homo sapiens)

ICTAKPRDIPMNPMCIYRSPETNRRVWELSKANSRFATTFYQHLADSKND
NDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFF
FAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQP
LDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFK
GLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQVLEL
PFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPR
FRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAF
LEVNEEASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVA
NPCV

3D structure

• PDB: 1br8 Implications for function and therapy of a 2.9 A structure of binary-complexed antithrombin.
• Chain: I
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	F77 S82 A86 V190 R197 I198 L210 T211 V212 L213 V214 L215 V216 N217 T218 I219 Y220 F221 G223 F274 L362 Y363 V364 S365 D366 A367 F368 H369 K370 A371 F372 L373 E374	F55 S60 A64 V168 R175 I176 L188 T189 V190 L191 V192 L193 V194 N195 T196 I197 Y198 F199 G201 F252 L340 Y341 V342 S343 D344 A345 F346 H347 K348 A349 F350 L351 E352

Gene Ontology

Molecular Function

• GO:0002020 protease binding
• GO:0004867 serine-type endopeptidase inhibitor activity
• GO:0005515 protein binding
• GO:0008201 heparin binding
• GO:0042802 identical protein binding

Biological Process

• GO:0007596 blood coagulation
• GO:0010466 negative regulation of peptidase activity
• GO:0030193 regulation of blood coagulation

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005788 endoplasmic reticulum lumen
• GO:0005886 plasma membrane
• GO:0062023 collagen-containing extracellular matrix
• GO:0070062 extracellular exosome
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1br8, PDBe:1br8, PDBj:1br8
• PDBsum: 1br8
• PubMed: 9761669
• UniProt: P01008|ANT3_HUMAN Antithrombin-III (Gene Name=SERPINC1)