Structure of PDB 4v4g Chain HX

Receptor sequence

>4v4gHX (length=86) Species: 562 (Escherichia coli)

AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGV
GMGRDHTLFALSDGKVVFINKGKGARFISIEAAQTE

3D structure

• PDB: 4v4g Structural basis for the control of translation initiation during stress.
• Chain: HX
• Resolution: 11.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	HX	A2 K4 K5 G8 S9 S10 K11 N12 R14 N17 P18 K19 Y20 L21 V23 K24 K25 F26 E29 V30 V31 K32 L37 V38 R39 Q40 R41 G42 V51 D56 H57 K66 F69 I70 N71 K72	A1 K3 K4 G7 S8 S9 K10 N11 R13 N16 P17 K18 Y19 L20 V22 K23 K24 F25 E28 V29 V30 K31 L36 V37 R38 Q39 R40 G41 V50 D55 H56 K65 F68 I69 N70 K71

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 20:36:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'HX', title = 'Structural basis for the control of translation initiation during stress.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='HX', title='Structural basis for the control of translation initiation during stress.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'HX'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='HX')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>