Structure of PDB 7y7a Chain HW

Receptor sequence

>7y7aHW (length=174) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

AFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASCMVS
DAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDAS
VLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERKMSF
AAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	HW	S12 K15	S9 K12
BS02	PEB	HW	D23 A26	D20 A23
BS03	PEB	HW	K28 N35 K36 L38 D39 A40 I142 F153 A154 G156 C158	K25 N32 K33 L35 D36 A37 I139 F150 A151 G153 C155
BS04	PEB	HW	C50 D54 G58 C61 I133 Q137 F141 E148	C47 D51 G55 C58 I130 Q134 F138 E145
BS05	PEB	HW	N72 C73 R77 C82 R84 D85 I88 V122	N69 C70 R74 C79 R81 D82 I85 V119

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum	7y7a
PubMed	36922595
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]